General Information

  • ID:  hor001141
  • Uniprot ID:  A0A7M7GA41
  • Protein name:  SIFamide
  • Gene name:  100578023
  • Organism:  Apis mellifera (Honeybee)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  YRKPPFNGSIF
  • Length:  11
  • Propeptide:  MVSTRLVLAVVAALFVLAISVDAAYRKPPFNGSIFGKRSNTITDYEITSRAMSSVCEVVSETCNAWLSRQDSN
  • Signal peptide:  MVSTRLVLAVVAALFVLAISVDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7GA41-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001141_AF2.pdbhor001141_ESM.pdb

Physical Information

Mass: 150406 Formula: C64H92N16O15
Absent amino acids: ACDEHLMQTVW Common amino acids: FP
pI: 10.45 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -68.18 Boman Index: -1883
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 35.45
Instability Index: 821.82 Extinction Coefficient cystines: 1490
Absorbance 280nm: 149

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera